Insert the snorkel into the bottle and then insert the snorkel into the snorkel clamp. Related Products: SpectraMax 384 Plus UV/Vis Microplate Reader, Molecular Devices SpectraMax M2e Microplate Readers, Molecular Devices SpectraMax M5 Multi-Mode Microplate Reader,. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. 4 µL DNA standards. Below is the list of Molecular Devices microplate readers and liquid handling instruments that are of out-of-production and are now considered obsolete. The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. craig@californialightworks. , FI 15 sec. SpectraMax® Gemini™ EM Microplate Reader, Molecular Devices. 7 are achievable. 00 USD BMG FLUOstar Omega Microplate Reader Unit2 - AV $10,295. One plate carrier adapter is provided with the instrument. For fluorescence intensity assays, the SpectraMax® M2 and M2e units feature an. 2. Sold as-is. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Validate the optical performance of your absorbance . The new SPECTRAmax® PLUS 384 is the only spectrophotometer with a built-in cuvette port and microplate drawer. 2 5. spr SpectraMax M2 M2e M3 M4 M5 M5e SpectraTest ABS2 v2. It measures the optical density (OD) of samples in both 96- and 384-well. Temperature control and shaking included as standard. 1. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. The SpectraMax® i3x Multi-Mode Microplate Reader measures absorbance, fluorescence, and luminescence with available upgrades including western blot, cell imaging, and fast kinetics with injectors plus additional detection modes. together with SpectraMax, VersaMax, VMax, and EMax microplate readers from Molecular Devices, offer a quality assurance screening solution for the detection of melamine contamination in such food products as milk, infant formula, pet food, and confectionery. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. ® reader to the computer. Instrument Description and Capabilities: Fluorescence. Typical applications for this powerful reader include DNA and RNA quantification. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. GETTING THE MOST FROM YOUR MOLECULAR DEVICES MICROPLATE SYSTEMS applications guide to microplate systems applications guide to microplate systemsSPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. SPECTRAmax® PLUS384 is the only spectrophotometer with a built-in cuvette port and microplate drawer. The SpectraMax i3x reader measures spectral-based absorbance, fluorescence, and luminescence with the added functionality of modular upgrades for western blot, imaging, and fast kinetics with injectors. SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. The reader is ideal for measuring flash and glow assays, including dual luciferase reporter gene, G protein-coupled receptor (GPCR) via aequorin, bioluminescence resonance energy transfer (BRET), and acridinium ester flash assays, in both 96- and 384-well plates. 96/384-FortheSpectraMax340PC384,presstoselecttoreada96-wellplateora384-wellplate. The SpectraMax ABS Plus Microplate Reader can run both cuvette-based and microplate based reader applications on the same instrument. Reads 96-well microplates in 5 seconds; Reads 384-well microplates in 16 seconds, Monochromator, tunable 1. These VWR® Plus Series stainless steel refrigerators feature a multi-functional design for laboratory use. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). As a generous estimate, you might consider 300 W (at 120 Volts) per Spectramax reader, plus another 300 W for the Computer. In case of a cuvette, the optical path is horizontal, hence. High-precision 9 channel system; filter-less with up to 6 wavelengths. With three modes of detection for full spectrum absorbance, fluorescence and luminescence, It is user upgradeable from 2 to 3 modes. Such cross talk can occur through the wall of a white 384 well microplate. 0 nm increments Wavelength Bandwidth: 2 nm Wavelength Accuracy: < ± 2. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. 304 signal level saturation. A preconfigured protocol with optimized reader settings enabled reading of a 384-well plate in just two minutes. More Product Information. 专为科研检测平台量身打造的灵活且强大的小型微孔板读板机（酶标仪），具备终点法和动力学检测模式，标准配置6块滤光片，覆盖蛋白定量、细胞活力、农药残留、ELISA实验等. , FI 45 sec. 6 (H) x 22. Key features 4 gain calibration failed. 00 USD Tecan Infinite 200 Pro M Plex Microplate Reader - AV $14,995. For wavelengths in the UV range above 220 nm,. SpectraMax ABS Plus SpectraTest ABS2 v1. The SpectraMax M5e Multi-Mode Microplate Reader features a triple-mode cuvette port, temperature control, microplate shaking, and the industry leading SoftMax Pro. The SpectraMax Plus 384 reader is equipped with an innovation patented by Molecular Devices, the PathCheck® sensor, which measures the depth of a sample in a microplate by optical path length. SpectraMax iD3 reader is built on the same foundation that has made our entire SpectraMax microplate reader product line among the most trusted in the industry. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax M2 and SpectraMax M2e. Each SpectraMax® 340 PC 384 Microplate Reader has an. Standard features include UV-visible absorbance in tunable 1,0 nm increments up to 4,0 nm, and fluorescence intensity with spectral scanning across the wavelength range in 1 nm increments and up to four wavelength pairs per protocol. 0nm increments. The SpectraMax ® Plus 384 Microplate Reader gives you walk-up convenience for both standard spectrophotometer and microplate reader applications on. GeneBLAzer® Compatible Microplate Reader Documentation. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a. to View. 96 wells 384 wells Absorbance 0:30 1:40 Fluorescence intensity 0:25 1:25 Luminescence 0:30 1:15. This UV-visible absorbance microplate reader provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. Wavelength range: Excitation: 250-850 nm, Emission: 360-850 nm. Validating the absorbance optical performance of your microplate reader is as simple as reading a plate. Cables. Keywords spectramax i3 multi-mode platform, spectramax i3, spectramax i3 system, scanlater western blot system, spectramax minimax imaging cytometer, softmax pro software, metamorph software. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 1000 nm). Molecular Devices SpectraMax Plus 384. The SpectraMax Paradigm Multi-Mode Detection. SpectraMax Microplate Readers. SpectraMax Plus 384 reads 96-well plates, 384-well plates, and cuvettes. The SpectraMax i3x reader has variable bandwidth for fluorescence and luminescence, and you are able to choose either 9nm or 15 nm for excitation and either 15 nm or 25 nm for emission. 76358-624. o SpectraMax M2 - Well Scan read mode - single well read coordinate problem fixed. 100 fmol 1536-well (8 µL) 0. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. It measures the optical density (OD) of samples in both 96- and 384-well microplates or in a cuvette at a selected wavelength for a single point in time (endpoint), over a specified period of time (kinetic), or over a selected. . Page 28 SpectraMax iD3 Multi-Mode Microplate Reader User Guide 4. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI) and have optical performance comparable to a top-of-the-line dedicated spectrofluorometer or. The Molecular Devices SpectraMax 384 is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and. 314 low lamp level warning. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. When reading optical density at wavelengths below 340 nm,. Digital controller and display. Computer and software not available. Capabilities include fluorescence and luminescence readings, environmental control, cell viability assays, enzyme. Avantor is setting science in motion for a better world | Avantor - VWROverview of 384-Well High Sample Recovery Plate. 96, 384 wells Light source Xenon flash lamp (1 joule/flash) Detector Photomultiplier tube (PMT) Read time** 96 wells: 384 wells: Abs 18 sec. . . Temperature control. Figure 1. spr SpectraMax iD5 SpectraTest ABS2 v1. SpectraMax and VersaMax Plate Readers OperatorÕs Manual Ñ 0112-0126 Rev A SpectraMax Plus 384 SpectraMax 190 SpectraMax 340PC 384 VersaMax Microplate Spectrophotometer Operator's Manual Molecular Devices Corporation 1311 Orleans Drive Sunnyvale, California 94089 Part # 0112-0126 Rev A. The SpectraMax Plus 384 Microplate Reader gives users the convenience of both standard spectrophotometer and microplate reader applications on the same instrument. SpectraMax® 340PC384 Microplate Reader for acquiring data in endpoint, kinetic, and spectral scan modes using wavelegths from 340-850 nm, tunable in 1 nm increments. 세포신호전달은 세포가 환경에 반응하고 다른 세포와 소통할 수 있게 합니다…. 306 plate air cal. The SpectraMax® 340 PC 384 Absorbance Microplate Reader from Molecular Devices provides the necessary tools for absorbance measurements in the visible range. Or, with the reader specifications noted from the Instrument Description section of your reader's manual, as well as those for your PC, you can calculate needs more closely. The SpectraMax® Glo Steady-Luc™ Reporter Assay Kit provides a highly sensitive assay for the quan-titation of firefly luciferase expression in mammalian cells. What is the minimum well volume needed to run a 384 well plate? Minimum volume depends on the solution (curved vs. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. spectraMax 340pc 384 Microplate reader. Detection cartridge modularity allows for easy addition of new read modes within minutes without. Learn how to operate the VersaMax, SpectraMax 340PC384 and SpectraMax 190 Plus384 microplate readers, which offer fast and accurate absorbance measurements for a. 과 같은 Parameter를 검사하여 평가할 수 있습니다. Ensure there are three inches between the back of the instrument and any other objects or surfaces so it has proper air flow. The SpectraMax M5e Micoplate Reader is the standard for UV/Visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes, 96-well and 384-well microplates. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Which SpectraMax Multi-Mode Microplate Reader do you need? Detection Modes Absorbance Fluorescence Intensity Luminescence Time-Resolved Fluorescence Fluorescence Polarization HTRF Upgrade Options Plate Formats 6-, 12-, 24-, 48-, 96-, 384-Well Microplates Certification and Validation IMAP Validation (TR-FRET only) (TR-FRET. Flexible Throughput Read one sample or up to 384 at a time – it’s your choice. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. The SpectraMax® Paradigm® Multi-Mode Microplate Reader measures absorbance, fluorescence, time-resolved fluorescence (including HTRF), fluorescence polarization, AlphaScreen®, AlphaLISA®, and luminescence assays for up to 1536-well plates. Instrument design, user interface capabilities, and cost play key roles in purchasing a suitable microplate reader. 996 (n = 3) ; for SpectraMax Plus 384 reader, r 2 = 0. Molecular Devices SpectraMax 384 Plus Microplate Reader Specifications. The SpectraMax reader’s optical system mimics a dual-beam spectrophotometer. 030 fmol Fluorescence Polarization (FP) (Fluorescein 1 nM, SD) 96-well (200 µL) 0. The technology allows automatic adjustment of good absorbance to a tube equivalent path length of 1 cm, converted to 96 or 384 tubes. 012 fmol 0. SUPPORTED PLATES Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax M2 and SpectraMax M2 . View the Molecular Devices website. The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. Temperature control and shaking included as standard. SpectraMax Plus384, 190, 340PC384, and VersaMax User Guide Molecular Devices User Guide SpectraMax Paradigm Microplate Reader General specifications User-upgradeable Multi-Mode Detection Platform Technical specifications Optimized Guaranteed* Fluorescence Intensity (FI) (Fluorescein) 96-well (200 µL) 0. 2 SpectraMax MiniMax300ImagingCytometer(cytometer) 3. SpectraMax ® Plus 384 optics. Experienced in operating and performing maintenance on numerous laboratory instrumentation from various large and small manufacturers including Spectramax 384 and i3 with Softmax software. Fluorescence filters included in 1nm range. The SpectraMax 340PC384 system has a monochromator instead of interference filters. microplates or in a cuvette at a. Slide the tip into the nozzle, the slots are labeled 1 and 2 for injector 1 and injector 2. For more sample throughput, both readers can be easily SpectraMax i3x Microplate Reader, Molecular Devices (Cat# i3X) 96-well white walled clear bottom plates, Costar (Cat# 3903) Purified luciferase, Promega (Cat# E1701) 384-well solid white plates, Greiner (Cat# 655075) CHO-K1 cells, ATCC (Cat# CCL-61) Complete Growth Media Ham’s F12 Medium, Life Technologies (Cat# 11765-54) SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. The SpectraMax M5e Reader offers the additional benefit of being certified for Cisbio Bioassays’ HTRF® Assays. Contact Us Phone: +1-800-635-5577 Web: Email: [email protected] are some cuvettes that have been tested in the M5 and Plus 384. Service Contracts, Preventative Maintenance and Performance. PathCheck Sensor. For more sample throughput, the system canMicroplate Spectrophotometers. Future ready The SpectraMax® i3x Multi-Mode microplate reader measures spectral-based Absorbance, Fluorescence, and Luminescence with the added functionality of modular. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export dataThe SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Key features 4 wells: 76 seconds Luminescence Specifications Dynamic Range < 6 decades Sensitivity 10 amol ATP General Specifications. SpectraDrop High-Throughput Screening (HTS) Kit. 305 reference level saturation. 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. Molecular Devices’ SpectraMax® Plus 384 Microplate Reader provides fast and reliable full spectral range detection for cuvettes, 96-well and 384-well microplates. 1. Set up SoftMax Pro Software to use PathCheck as detailed above. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselectedwavelengthsina singlereadmode. 5065390D 3 Contents SafetyInformation 4 Warnings,Cautions,Notes,andTips 4 Chapter1:Introduction 7 ComputerIntegration 8 PlateControls 9 CuvetteChamber 10 Multimode Reader Comparison Chart. The SpectraMax reader’s optical system mimics a dual-beam spectrophotometer. used. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. 384-well: Abs 49 sec. Easy-to-use, robust assay kits for. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Molecular Devices Spectramax 384 Plus Microplate Reader. Read one sample or up to 384 at a time – it’s your choice. Published Dec 16, 2020 | Updated Dec 16, 2020. Abs 49 sec. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Spectrophotometer 또는 Microplate Reader 상의 260nm에서 측정된 DNA 샘플의 흡광도는…. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. 5 mP 6 mP * For properly functioning, operated, and maintained equipment. Molecular Devices UVmax Kinetic Microplate Reader. The optical system of the SpectraMax 190 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 850 nm). SpectraMax 190 reads 96-well plates. Products : SpectraMax Plus 384 reader, SpectraMax 190 reader, SpectraMax 340PC 384 (Obsolete), SpectraMax 250 (Obsolete), SpectraMax 340 (Obsolete), VersaMax reader How does stray light affect my OD reading? The basic problem caused by stray light (light you don't want, getting into the read) is a falsely low OD seen. 0 OD for earlier models. spr SpectraMax Plus 384. It measures the optical density (OD) of samples in both 96- and 384-well. 304 signal level saturation. By measuring optical pathlength, it eliminates the last major distinction between microplate readers and spectrophotometers. 96- or 384-well microplate compatibility. The AquaMax® Microplate Washer is a fully self-contained system, configurable for both 96- and 384-well microplates. Standard features include a cuvette port, spectral scanning in 1 nm increments, and up to six wavelengths per read. Includes: Computer Loaded with SoftMax Pro 5. Products : FlexStation 3 reader, SpectraMax M5/M5e reader, SpectraMax M2/M2e reader. This UV-visible absorbance microplate reader provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. Also refer to this Multimode Reader Comparison Chart. The optical performance is comparable to a top-of-the-line dedicated Which SpectraMax M Series reader do you need? SpectraMax M Series Multi-Mode Microplate Readers 5 Ordering information VWR cat. Time Resolved Fluorescence: Solid white plates for top reads and white plates with clear bottoms for bottom reads. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SPECTRAmax GEMINI XS. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in. Both the SpectraMax M5 and the Gemini EM are monochromator-based, microplate readers. The SpectraMax® Plus 384 adds the ability to read cuvettes. Multimode Reader Comparison Chart. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers can measure absorbance, fluorescence and luminescence. Users can password-protect data, choose from nine different curve-fitting routines and use default data reduction, or set up custom formulas for analysis. For more sample throughput, both readers can be easilySpectraMax i3x Microplate Reader, Molecular Devices (Cat# i3X) 96-well white walled clear bottom plates, Costar (Cat# 3903) Purified luciferase, Promega (Cat# E1701) 384-well solid white plates, Greiner (Cat# 655075) CHO-K1 cells, ATCC (Cat# CCL-61) Complete Growth Media Ham’s F12 Medium, Life Technologies (Cat# 11765-54)SpectraMax190,340PC384,Plus384,VersaMaxMicroplateSpectrophotometersUserGuide 8 0112-0126D ComputerIntegration. Using the patented PathCheck® Pathlength Measurement Technology, the SpectraMax M4 Microplate Reader transforms each well in a microplate to a fixed. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. Item SpectraMax 340PC 384 Tunable Spectrophotometer with SoftMax Pro Software; Company Molecular Devices LLC; This product is no longer available on Biocompare. Published Dec 16, 2020 | Updated Dec 16, 2020. Please see part number 6007619, sterile,. SpectraMax ® Plus 384 optics. The SpectraMax Paradigm Platform was able to quantify the protein down to the low picomolar level using an AlphaLISA method (Figure 1). Detection modalities are shown in Table 1-1. Temperature range between 4°C above ambient to 45°C. 2. SpectraMax® ABS Plus microplate reader can run both cuvette-based and microplate reader applications on the same instrument. Clamp for injector 1 is on the left and clamp for injector 2 is on the right. no. Page 14: Component Description† Bottom mounting for SpectraMax Paradigm Readers only. 0112-0115J 9 Chapter1:Introduction TheSpectraMax®M3Multi-ModeMicroplateReader,SpectraMax®M4Multi-ModeMicroplate Reader,SpectraMax®M5Multi-ModeMicroplateReader,andSpectraMax®M5eMulti-ModeNote: for SpectraMax microplate readers without a cuvette port, the water constant is automatically used in PathCheck calculations, and no Water Constant option appears in the Instrument Settings. Cross-talk < 0. The SpectraMax® M5 Multi-Mode Microplate Reader delivers single mode reader performance and can be equipped to read volumes as low as 2uL in one multimode reader package. 384-well microplate for use in time-resolved fluorescence, luminescence, Alpha, and radiometric assays. SpectraMax M series, Gemini, and SpectraMax iDx readers have xenon flash lamps,. 1. ester flash assays, in both 96- and 384-well plates. Time Resolved Fluorescence. SpectraMax L Microplate Reader is a sensitive luminometer with programmable injector options that measures flash and glow luminescence assays, including dual luciferase reporter gene, G protein-coupled receptor (GPCR) in 96- and 384-well plates. When reading optical density at wavelengths below 340 nm, special UV-transparent, disposable or quartz microplates allowing transmission of the deep UV spectra must be used. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. Abs 49 sec. Published Dec 16, 2020 | Updated May 19, 2023. Key applications**. UV/Vis spectrophotometer & microplate reader with built-in cuvette port. Analyst, M5, Flex 3, and SpectraMax L readers work differently. Digital controller and display. The optical systems use two scanning monochromators soSpectramax Plus 384 Microplate Reader is available from The Lab World Group. SpectraMax i3x Multi-Mode Microplate Reader. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. Detection of species collected on membrane plates is also. Wavelength optimization. It provides ready-to-run protocols, analysis algorithms, and 21 different curve fit options. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. The following document is intended to demonstrate setup of this. , FI 45 sec. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time. When you do a read at wavelengths below 340 nm, you must use special UV-transparent, disposable or quartz plates to allow transmission of the deep UV spectra. The eight-channel system delivers both high precision and speed when reading 96- and 384-well microplates for endpoint measurements, kinetic assays, and spectral scans. The SpectraMax® Gemini™ EM Microplate Spectrofluorometer from Molecular Devices® provides a flexible environment. 9. 384 wells: Abs 49 sec. This UV-visible absorbance microplate reader provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. Microplate spectrophotometers, also called microplate readers, allow researchers to analyze multiple samples in parallel using 6- to 1536-well formats, as opposed to single sample measurements. SpectraMax and VersaMax Plate Readers Operator’s Manual — 0112-0126 Rev A SpectraMax Plus384 SpectraMax 190 SpectraMax 340PC384 VersaMax Microplate Spectrophotometer Operator's Manual Molecular Devices Corporation 1311 Orleans Drive Sunnyvale, California 94089 Part # 0112-0126 Rev A. This integrated system. where. To prevent such interference, select the Interlaced Reading option to read every other well in a checkerboard pattern in the first run and then read the previously omitted wells in a second run. Shaking capabilities. the SpectraMax iD3 is a fantastic plate reader for a wide range of assays. 1 Figure from 528 Publications Molecular Devices LLC. plates < 100 amol (384-well) 1. Biocompare is the leading resource for up-to. In addition, the iD5 reader can measure TRF and FP, and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter gene detection with syringe and Western blot detection. An ATP standard curve spanning five decades was run using the ATPlite 1step Luminescence Assay System (PerkinElmer) on the SpectraMax iD3 reader. 96-well Half Area 384- Low Volume 1536- Microplate Material 96-well Stripwell 96-well well 384-well well Clear polystyrene n n n n Solid black or white polystyrene n n n n n n Clear bottom black or white polystyrene n n n n n Polypropylene n n n Solid black or white polypropylene n n*SpectraMax Paradigm Multi-Mode Detection Platform User Guide Loading and Unloading Microplates To load or unload a microplate: 1. Operators can conveniently select up to six wavelengths at a time for absorbance detection in the visible wavelength range of 340 nm – 850 nm. Tb donor/red acceptor. 1, All Necessary Cables and Cords, Manuals. 3) This warranty covers the SPECTRAmax PLUS 384384-well clear-bottom, scintillating microplate for cell-based radiometric proximity assays. For 40 years, we have partnered with scientists to help them achieve landmark discoveries. 1. The SpectraMax® ABS Plus Microplate Reader can run . microplates or in a cuvette at a. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. With optimized reagents, option to operate the. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. The standard 8 filter modes enable endpoint and kinetic applications such as protein quantification, cell viability and ELISA. Or scan up to 384 wells at any time to. Learn how SpectraMax Plus 384 Microplate Reader & SoftMax Pro Software used for Phenolic compounds measurement in red wines which efficiently collect and analyze the data for this assay. 020 fmol 0. Detection modalities are shown in Table 1-1. High sample correlation coefficients (R 2) make it easy to. SpectraMax190reads96-wellplates. With optimized reagents and the industry-leading data acquisition and analysis tool, SoftMax Pro® 7 Software, the SpectraMax® iD3. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. Select the Driver tab and click Update Driver. to View Figures. The plate reader optics are tunable for absorbance, fluorescence intensity, fluorescence polarization, and time resolved fluorescence assays (TRF). The Molecular Devices SpectraMax M5E is a multi-mode plate reader that delivers single mode reader performance with five preferred detection modes for a wide range of applications. Product Specs; Item SpectraMax Plus 384 Spectrophotometer; Company Molecular Devices LLC; This product is no longer available on Biocompare. tools to expand the. There should be a value for 900 and 1000. The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. Temperature control. both cuvette-based and microplate reader applications on the same instrument. The Spectramax 384Plus is a microplate spectrofluorometer from Molecular Devices. Explore how the SpectraMax i3 Multi-Mode Platform provides an unlimited breadth of application possibilities, and how it can evolve with your future needs. the SpectraMax iD3 is a fantastic plate reader for a wide range of. 0112-0115J 9 Chapter1:Introduction TheSpectraMax®M3Multi-ModeMicroplateReader,SpectraMax®M4Multi-ModeMicroplate Reader,SpectraMax®M5Multi-ModeMicroplateReader,andSpectraMax®M5eMulti-Mode Molecular Devices SpectraMax Plus 384. and detection of plate formats from 6- to 384-wells, the SpectraMax iD5 reader is the complete solution for all your research needs. BOE offers an extensive inventory of competitively priced Lab Equipment. 997 (n = 3). This product is no longer available on Biocompare. The SpectraMax® ABS Plus Microplate Reader can run both cuvette-based and microplate reader applications on the same instrument. SpectraMax™ Plus 384 VersaMax™The SpectraMax M2e is a dual-monochromator, multi-detection microplate reader with a dual-mode cuvette port and 96 or 384 microplate reading capability. Computer and software not available. 9 in. 190-1000 nm. Microplate Readers include the M3, M4,. Absorbance = E * C * L. 0200-6262. Mode 96-well 384-well 1536-well Optimizedforspeed 12seconds 25seconds 50seconds Optimizedforperformance 20seconds 40seconds 80seconds Table1-1:PlateReadTimesforOn-the-FlyDetection(± 5. With optimized reagents and the industry leading data acquisition and analysis tool, SoftMax® Pro 7 Software, the SpectraMax to perfectly match your needs. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Top detection is available for fluorescence detection on the SpectraMax M2, while top and bottom reads are possible on the SpectraMax M2 e. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. 1. Used MOLECULAR DEVICES SPECTRAmax 384 Spectrophotometer For Sale - DOTmed Listing #2356563: Spectra Max Plus 384 Microplate Spectrophotometer - GOOD WORKING UNIT Equipment was recently removed. 312 gain calibration failed. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). 190-1000 nm. The SpectraMax® and VersaMax™ require proper ventilation to keep their internal components cool. It can be upgraded with modules such as imaging cytometer, western blot imager, and injectors to expand its capabilities. The optical performance is comparable to a top-of-the-line dedicatedSpectraMax 340PC384的光学设计真实地模 拟双光束分光光度计。每个孔有其各自的 样品光束检测和参比检测。8通道的系统， 包含8条样品检测光束和8条参比光束，给 予出众的精确度和高速读板方式。 不需要滤光片 SpectraMax 340PC384使用光栅单色器代替 滤光片。Explore more about Optimized settings for Transcreener TR-FRET assay on SpectraMax iD5 and SpectraMax i3x readers. formats from 6- to 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. Expanding The Boundaries of Microplate Reader Functionality - The. 5 mP 3 mP 1536-well (8 µL) 1. The light transmittance was evaluated as function of wavelength of the BNC membranes. Also refer to this Multimode Reader Comparison Chart. The SpectraMax L reader is upgradeable to dual-channel configurations for a 2-fold. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. Our absorbance plate readers feature our PathCheck Sensor technology and. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI). 305 reference level saturation. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. spr SpectraMax M2 M2e M3 M4 M5 M5e SpectraTest ABS2 v1. In addition, the iD5 reader can measure TRF and FP, and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter gene detection with syringe and Western blot detection. The optical performance is comparable to a top-of-the-line dedicatedDescription Microplates The SpectraMax Multi-Mode Microplate Reader can accommodate SBS- standard 6-well to 384-well microplates and strip wells. 8 (W) x 15 (D)SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. Contact Information: Craig Adams. The SpectraTest® Validation Plates are valuable tools for verifying that absorbance-, fluorescence-, and luminescence-capable microplate readers are operating correctly for GMP and GLP laboratories. o SpectraMax M2 - Instrument boot-up problem while connected to SoftMax Pro has been fixed o LMax II - Fast Kinetic read mode button icon is fixed to show the selected state. For more sample throughput, the system canThis version is compatible with the following instruments: SpectraMax® Mini Multi-Mode Microplate Reader (software version 7. 384 distinct wells in a source plate to a read plate, simultaneously. Five-mode microplate reading with superior optics Unique optical characteristics 1. 96 , 384 , and 1536 well microplates Note: Detection Cartridges and PC not included. These models can no longer be repaired. It is an innovative way of normalizing the absorbance reading in a microplate well to that of a 1-cm cuvette. SpectraMax 340PC384: SpectraMax Plus384: VERSAmax: Vmax: Tecan: Sunrise: Trinean: DropSense96: AMBIENT TEMPERATURE STORAGE: Liconic: LPX 220 Hotel: LPX 440 Hotel:. The Molecular Devices SpectraMax® M5/M5e Microplate Reader was tested for compatibility with Life Technologies GeneBLAzer® assays. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. The reader adds up to three transfers of assay reagents from a 96- or 384-well source plate to enhance assay design using integrated fluidics. Molecular Devices. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. The SpectraMax Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. For more information, please visit us at 384 Plus UV/Vis Microplate Reader, Molecular Devices.